PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g14720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 283aa    MW: 31795.2 Da    PI: 9.7
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g14720.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.48.1e-142670147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +W++eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
   Vang04g14720.1 26 RESWSEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 70
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.04E-172076IPR009057Homeodomain-like
PROSITE profilePS5129415.8492175IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-62476IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-182473IPR006447Myb domain, plants
SMARTSM007172.2E-112573IPR001005SANT/Myb domain
PfamPF002491.4E-112670IPR001005SANT/Myb domain
CDDcd001674.16E-92871No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MAMAPSTPSS GSGKKVRKPY TITKSRESWS EEEHDKFLEA LQLFDRDWKK IEDFVGSKTV  60
IQIRSHAQKY FLKVQKNGTV AHVPPPRPKR KAAHPYPQKE SKNVLVPFPA SLAYVSPTWD  120
ESFLLMSSGS NRSLPYQDEL TNLHGDEGMP DIGSKGVTMI GNSCVSDVGN STRKLSATEI  180
PKQGKQTQVL HGLPDFAEVY SFIGSIFDPD TEGHVQKLKE MDPINFETVL LLMKNLTLNL  240
SSPDFVPVRK AMSSYDANTE LRQELMSRNR QRIYNVKQLN KH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150379e-71AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495340.10.0PREDICTED: protein REVEILLE 8-like isoform X1
SwissprotQ8RWU31e-120RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A0S3RYU50.0A0A0S3RYU5_PHAAN; Uncharacterized protein
STRINGGLYMA19G36170.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67353449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.19e-97MYB_related family protein